Lineage for d1hzta_ (1hzt A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.113: Nudix [55810] (1 superfamily) Superfamily d.113.1: Nudix [55811] (2 families) 
Family d.113.1.2: Isopentenyl diphosphate isomerase [64369] (1 protein) Protein Isopentenyl diphosphate isomerase [64370] (1 species) Species Escherichia coli [TaxId:562] [64371] (3 PDB entries) 
Domain d1hzta_: 1hzt A: [61459]
Details for d1hzta_
PDB Entry: 1hzt (more details), 1.45 Å
PDB Description: crystal structure of metal-free isopentenyl diphosphate:dimethylallyl diphosphate isomerase
SCOP Domain Sequences for d1hzta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli}
lhlafsswlfnakgqllvtrralskkawpgvwtnsvcghpqlgesnedavirrcryelgv
eitppesiypdfryratdpsgivenevcpvfaarttsalqinddevmdyqwcdladvlhg
idatpwafspwmvmqatnrearkrlsaftqlkl
SCOP Domain Coordinates for d1hzta_:
Click to download the PDB-style file with coordinates for d1hzta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hzta_:
- d1hzta_ is new in SCOP 1.57
- d1hzta_ appears in SCOP 1.59
- d1hzta_ appears in the current release, SCOPe 2.08, called d1hzta1
View in 3D