SCOP 1.59: Domain d1hzpb2: 1hzp B:175-317

Lineage for d1hzpb2 (1hzp B:175-317)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (5 proteins)

6. Protein Ketoacyl-ACP synthase III (FabH) [53912] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [64196] (1 PDB entry)

8. Domain d1hzpb2: 1hzp B:175-317 [61458]

Details for d1hzpb2

PDB Entry: 1hzp, 2.1 Å

PDB Description: crystal structure of the myobacterium tuberculosis beta-ketoacyl-acyl carrier protein synthase iii

SCOP Domain Sequences for d1hzpb2:

Sequence; same for both SEQRES and ATOM records:

>d1hzpb2 c.95.1.1 (B:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis}
gptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrramda
agvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplamaellt
tgaakpgdlalligygaglsyaaqvvrm

Timeline for d1hzpb2:

• d1hzpb2 first appeared in SCOP 1.57
  
• d1hzpb2 appears in SCOP 1.61
  
• d1hzpb2 appears in the current release, SCOPe 2.08