![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) |
![]() | Superfamily c.95.1: Thiolase-like [53901] (2 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (5 proteins) |
![]() | Protein Ketoacyl-ACP synthase III (FabH) [53912] (2 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [64196] (1 PDB entry) |
![]() | Domain d1hzpb2: 1hzp B:175-317 [61458] |
PDB Entry: 1hzp (more details), 2.1 Å
SCOP Domain Sequences for d1hzpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzpb2 c.95.1.1 (B:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis} gptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrramda agvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplamaellt tgaakpgdlalligygaglsyaaqvvrm
Timeline for d1hzpb2: