SCOP 1.75: Domain d1hzpb1: 1hzp B:-10-174

Lineage for d1hzpb1 (1hzp B:-10-174)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)

6. Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [64196] (12 PDB entries)

8. Domain d1hzpb1: 1hzp B:-10-174 [61457]

Details for d1hzpb1

PDB Entry: 1hzp, 2.1 Å

PDB Description: crystal structure of the myobacterium tuberculosis beta-ketoacyl-acyl carrier protein synthase iii

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase III

SCOP Domain Sequences for d1hzpb1:

Sequence; same for both SEQRES and ATOM records:

>d1hzpb1 c.95.1.2 (B:-10-174) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
fqgi

Timeline for d1hzpb1:

• d1hzpb1 first appeared in SCOP 1.57
  
• d1hzpb1 appears in SCOP 1.73
  
• d1hzpb1 appears in SCOPe 2.01
  
• d1hzpb1 appears in the current release, SCOPe 2.08