| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (2 families) ![]() |
| Family c.95.1.2: Chalcone synthase-like [53914] (7 proteins) |
| Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [64196] (2 PDB entries) |
| Domain d1hzpb1: 1hzp B:-10-174 [61457] |
PDB Entry: 1hzp (more details), 2.1 Å
SCOP Domain Sequences for d1hzpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzpb1 c.95.1.2 (B:-10-174) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis}
mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
fqgi
Timeline for d1hzpb1: