Lineage for d1hzpa2 (1hzp A:175-317)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881522Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 1881650Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)
  7. 1881678Species Mycobacterium tuberculosis [TaxId:1773] [64196] (12 PDB entries)
  8. 1881700Domain d1hzpa2: 1hzp A:175-317 [61456]
    complexed with dao, gol

Details for d1hzpa2

PDB Entry: 1hzp (more details), 2.1 Å

PDB Description: crystal structure of the myobacterium tuberculosis beta-ketoacyl-acyl carrier protein synthase iii
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase III

SCOPe Domain Sequences for d1hzpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzpa2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
gptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrramda
agvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplamaellt
tgaakpgdlalligygaglsyaaqvvrm

SCOPe Domain Coordinates for d1hzpa2:

Click to download the PDB-style file with coordinates for d1hzpa2.
(The format of our PDB-style files is described here.)

Timeline for d1hzpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hzpa1