Lineage for d1hzpa1 (1hzp A:-10-174)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 593921Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 593922Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 594204Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)
  6. 594307Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)
  7. 594327Species Mycobacterium tuberculosis [TaxId:1773] [64196] (2 PDB entries)
  8. 594328Domain d1hzpa1: 1hzp A:-10-174 [61455]

Details for d1hzpa1

PDB Entry: 1hzp (more details), 2.1 Å

PDB Description: crystal structure of the myobacterium tuberculosis beta-ketoacyl-acyl carrier protein synthase iii

SCOP Domain Sequences for d1hzpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzpa1 c.95.1.2 (A:-10-174) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis}
mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
fqgi

SCOP Domain Coordinates for d1hzpa1:

Click to download the PDB-style file with coordinates for d1hzpa1.
(The format of our PDB-style files is described here.)

Timeline for d1hzpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hzpa2