Lineage for d1hzpa1 (1hzp A:-10-174)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75535Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. 75536Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 75537Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. 75631Protein Ketoacyl-ACP synthase III (FabH) [53912] (2 species)
  7. 75649Species Mycobacterium tuberculosis [TaxId:1773] [64196] (1 PDB entry)
  8. 75650Domain d1hzpa1: 1hzp A:-10-174 [61455]

Details for d1hzpa1

PDB Entry: 1hzp (more details), 2.1 Å

PDB Description: crystal structure of the myobacterium tuberculosis beta-ketoacyl-acyl carrier protein synthase iii

SCOP Domain Sequences for d1hzpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzpa1 c.95.1.1 (A:-10-174) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis}
mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
fqgi

SCOP Domain Coordinates for d1hzpa1:

Click to download the PDB-style file with coordinates for d1hzpa1.
(The format of our PDB-style files is described here.)

Timeline for d1hzpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hzpa2