Lineage for d1hzla_ (1hzl A:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.7: Actinoxanthin-like [49319] (1 family) 
Family b.1.7.1: Actinoxanthin-like [49320] (5 proteins) 
Protein Antitumor antibiotic C-1027 apoprotein [63675] (1 species) Species Streptomyces globisporus [TaxId:1908] [63676] (2 PDB entries) 
Domain d1hzla_: 1hzl A: [61453]
Details for d1hzla_
PDB Entry: 1hzl (more details)
PDB Description: solution structures of c-1027 apoprotein and its complex with the aromatized chromophore
SCOP Domain Sequences for d1hzla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzla_ b.1.7.1 (A:) Antitumor antibiotic C-1027 apoprotein {Streptomyces globisporus}
apafsvspasglsdgqsvsvsvsgaaagetyyiaqcapvggqdacnpatatsfttdasga
asfsfvvrksytgstpegtpvgsvdcataacnlgagnsgldlghvaltfg
SCOP Domain Coordinates for d1hzla_:
Click to download the PDB-style file with coordinates for d1hzla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hzla_:
- d1hzla_ is new in SCOP 1.57
- d1hzla_ appears in SCOP 1.59
- d1hzla_ appears in the current release, SCOPe 2.08
View in 3D