SCOPe 2.05: Domain d1hzia_: 1hzi A:

Lineage for d1hzia_ (1hzi A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-4 (IL-4) [47291] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47292] (16 PDB entries)

8. Domain d1hzia_: 1hzi A: [61449]
   complexed with so4; mutant

Details for d1hzia_

PDB Entry: 1hzi, 2.05 Å

PDB Description: interleukin-4 mutant e9a

PDB Compounds: (A:) interleukin-4

SCOPe Domain Sequences for d1hzia_:

Sequence; same for both SEQRES and ATOM records:

>d1hzia_ a.26.1.2 (A:) Interleukin-4 (IL-4) {Human (Homo sapiens) [TaxId: 9606]}
hkcditlqaiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhe
kdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlktim
rekyskcss

Timeline for d1hzia_:

• d1hzia_ first appeared in SCOP 1.57
  
• d1hzia_ appears in SCOPe 2.04
  
• d1hzia_ appears in SCOPe 2.06
  
• d1hzia_ appears in the current release, SCOPe 2.08