Lineage for d1hzia_ (1hzi A:)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.26: 4-helical cytokines [47265] (1 superfamily) Superfamily a.26.1: 4-helical cytokines [47266] (3 families) 
Family a.26.1.2: Short-chain cytokines [47286] (10 proteins) Protein Interleukin-4 (IL-4) [47291] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47292] (13 PDB entries) 
Domain d1hzia_: 1hzi A: [61449]
Details for d1hzia_
PDB Entry: 1hzi (more details), 2.05 Å
PDB Description: interleukin-4 mutant e9a
SCOP Domain Sequences for d1hzia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzia_ a.26.1.2 (A:) Interleukin-4 (IL-4) {Human (Homo sapiens)}
hkcditlqaiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhe
kdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlktim
rekyskcss
SCOP Domain Coordinates for d1hzia_:
Click to download the PDB-style file with coordinates for d1hzia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hzia_:
- d1hzia_ is new in SCOP 1.57
- d1hzia_ appears in SCOP 1.59
- d1hzia_ appears in the current release, SCOPe 2.08
View in 3D