Lineage for d1hzhm1 (1hzh M:1-107)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158485Species Intact IgG B12 antibody (human), kappa L chain [63639] (1 PDB entry)
  8. 158489Domain d1hzhm1: 1hzh M:1-107 [61447]
    Other proteins in same PDB: d1hzhh2, d1hzhh3, d1hzhh4, d1hzhk2, d1hzhk3, d1hzhk4, d1hzhl2, d1hzhm2

Details for d1hzhm1

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design

SCOP Domain Sequences for d1hzhm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzhm1 b.1.1.1 (M:1-107) Immunoglobulin (variable domains of L and H chains) {Intact IgG B12 antibody (human), kappa L chain}
eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerk

SCOP Domain Coordinates for d1hzhm1:

Click to download the PDB-style file with coordinates for d1hzhm1.
(The format of our PDB-style files is described here.)

Timeline for d1hzhm1: