![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88522] (8 PDB entries) |
![]() | Domain d1hzhl1: 1hzh L:1-107 [61445] Other proteins in same PDB: d1hzhh1, d1hzhh2, d1hzhh3, d1hzhh4, d1hzhk1, d1hzhk2, d1hzhk3, d1hzhk4, d1hzhl2, d1hzhm2 part of intact IgG B12 antibody |
PDB Entry: 1hzh (more details), 2.7 Å
SCOPe Domain Sequences for d1hzhl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzhl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]} eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerk
Timeline for d1hzhl1: