Lineage for d1hzhk2 (1hzh K:114-235)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655115Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655292Domain d1hzhk2: 1hzh K:114-235 [61442]
    Other proteins in same PDB: d1hzhh1, d1hzhh3, d1hzhh4, d1hzhk1, d1hzhk3, d1hzhk4, d1hzhl1, d1hzhl2, d1hzhm1, d1hzhm2
    part of intact IgG B12 antibody
    complexed with fuc, gal, man, nag

Details for d1hzhk2

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design
PDB Compounds: (K:) immunoglobulin heavy chain

SCOP Domain Sequences for d1hzhk2:

Sequence, based on SEQRES records: (download)

>d1hzhk2 b.1.1.2 (K:114-235) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdk

Sequence, based on observed residues (ATOM records): (download)

>d1hzhk2 b.1.1.2 (K:114-235) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdk

SCOP Domain Coordinates for d1hzhk2:

Click to download the PDB-style file with coordinates for d1hzhk2.
(The format of our PDB-style files is described here.)

Timeline for d1hzhk2: