![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
![]() | Species Intact IgG B12 antibody (human), kappa L chain [63639] (1 PDB entry) |
![]() | Domain d1hzhk1: 1hzh K:1-113 [61441] Other proteins in same PDB: d1hzhh2, d1hzhh3, d1hzhh4, d1hzhk2, d1hzhk3, d1hzhk4, d1hzhl2, d1hzhm2 |
PDB Entry: 1hzh (more details), 2.7 Å
SCOP Domain Sequences for d1hzhk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzhk1 b.1.1.1 (K:1-113) Immunoglobulin (variable domains of L and H chains) {Intact IgG B12 antibody (human), kappa L chain} qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg ttvivss
Timeline for d1hzhk1: