![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88590] (20 PDB entries) |
![]() | Domain d1hzhh4: 1hzh H:360-478 [61440] Other proteins in same PDB: d1hzhh1, d1hzhh2, d1hzhh3, d1hzhk1, d1hzhk2, d1hzhk3, d1hzhl1, d1hzhl2, d1hzhm1, d1hzhm2 |
PDB Entry: 1hzh (more details), 2.7 Å
SCOP Domain Sequences for d1hzhh4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzhh4 b.1.1.2 (H:360-478) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)} kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
Timeline for d1hzhh4: