Lineage for d1hzhh4 (1hzh H:360-478)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365577Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 365580Species Human (Homo sapiens) [TaxId:9606] [88590] (20 PDB entries)
  8. 365592Domain d1hzhh4: 1hzh H:360-478 [61440]
    Other proteins in same PDB: d1hzhh1, d1hzhh2, d1hzhh3, d1hzhk1, d1hzhk2, d1hzhk3, d1hzhl1, d1hzhl2, d1hzhm1, d1hzhm2

Details for d1hzhh4

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design

SCOP Domain Sequences for d1hzhh4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzhh4 b.1.1.2 (H:360-478) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk

SCOP Domain Coordinates for d1hzhh4:

Click to download the PDB-style file with coordinates for d1hzhh4.
(The format of our PDB-style files is described here.)

Timeline for d1hzhh4: