Lineage for d1hzhh4 (1hzh H:360-478)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221829Species Intact IgG B12 antibody (human), kappa L chain [63652] (1 PDB entry)
  8. 221832Domain d1hzhh4: 1hzh H:360-478 [61440]
    Other proteins in same PDB: d1hzhh1, d1hzhk1, d1hzhl1, d1hzhm1

Details for d1hzhh4

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design

SCOP Domain Sequences for d1hzhh4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzhh4 b.1.1.2 (H:360-478) Immunoglobulin (constant domains of L and H chains) {Intact IgG B12 antibody (human), kappa L chain}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk

SCOP Domain Coordinates for d1hzhh4:

Click to download the PDB-style file with coordinates for d1hzhh4.
(The format of our PDB-style files is described here.)

Timeline for d1hzhh4: