Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Intact IgG B12 antibody (human), kappa L chain [63639] (1 PDB entry) |
Domain d1hzhh1: 1hzh H:1-113 [61437] Other proteins in same PDB: d1hzhh2, d1hzhh3, d1hzhh4, d1hzhk2, d1hzhk3, d1hzhk4, d1hzhl2, d1hzhm2 |
PDB Entry: 1hzh (more details), 2.7 Å
SCOP Domain Sequences for d1hzhh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzhh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Intact IgG B12 antibody (human), kappa L chain} qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg ttvivss
Timeline for d1hzhh1: