Lineage for d1hzhh1 (1hzh H:1-113)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52649Species Intact IgG B12 antibody (human), kappa L chain [63639] (1 PDB entry)
  8. 52650Domain d1hzhh1: 1hzh H:1-113 [61437]
    Other proteins in same PDB: d1hzhh2, d1hzhh3, d1hzhh4, d1hzhk2, d1hzhk3, d1hzhk4, d1hzhl2, d1hzhm2

Details for d1hzhh1

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design

SCOP Domain Sequences for d1hzhh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzhh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Intact IgG B12 antibody (human), kappa L chain}
qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
ttvivss

SCOP Domain Coordinates for d1hzhh1:

Click to download the PDB-style file with coordinates for d1hzhh1.
(The format of our PDB-style files is described here.)

Timeline for d1hzhh1: