Lineage for d1hzeb_ (1hze B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560964Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 561110Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 561228Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
    duplication: consists of two homologous domains
  6. 561229Protein Riboflavin synthase [63784] (2 species)
    trimerizes via the additional C-terminal helix
  7. 561230Species Escherichia coli [TaxId:562] [63785] (4 PDB entries)
  8. 561242Domain d1hzeb_: 1hze B: [61435]
    N-terminal domain only
    complexed with rbf

Details for d1hzeb_

PDB Entry: 1hze (more details)

PDB Description: solution structure of the n-terminal domain of riboflavin synthase from e. coli

SCOP Domain Sequences for d1hzeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzeb_ b.43.4.3 (B:) Riboflavin synthase {Escherichia coli}
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnveraakfsdeiggh

SCOP Domain Coordinates for d1hzeb_:

Click to download the PDB-style file with coordinates for d1hzeb_.
(The format of our PDB-style files is described here.)

Timeline for d1hzeb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hzea_