Class b: All beta proteins [48724] (126 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) |
Family b.43.4.3: Riboflavin synthase [63783] (1 protein) duplication: consists of two homologous domains |
Protein Riboflavin synthase [63784] (2 species) trimerises via the additional C-terminal helix |
Species Escherichia coli [TaxId:562] [63785] (3 PDB entries) |
Domain d1hzea_: 1hze A: [61434] |
PDB Entry: 1hze (more details)
SCOP Domain Sequences for d1hzea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzea_ b.43.4.3 (A:) Riboflavin synthase {Escherichia coli} mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs fdlmketlritnlgdlkvgdwvnveraakfsdeiggh
Timeline for d1hzea_: