Lineage for d1hz8a1 (1hz8 A:1-41)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 621450Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 622118Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 622119Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 622279Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species)
  7. 622280Species Human (Homo sapiens) [TaxId:9606] [64540] (6 PDB entries)
  8. 622285Domain d1hz8a1: 1hz8 A:1-41 [61432]

Details for d1hz8a1

PDB Entry: 1hz8 (more details)

PDB Description: solution structure and backbone dynamics of a concatemer of egf- homology modules of the human low density lipoprotein receptor

SCOP Domain Sequences for d1hz8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hz8a1 g.3.11.1 (A:1-41) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens)}
gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrced

SCOP Domain Coordinates for d1hz8a1:

Click to download the PDB-style file with coordinates for d1hz8a1.
(The format of our PDB-style files is described here.)

Timeline for d1hz8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hz8a2