Lineage for d1hz6c_ (1hz6 C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503865Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2503866Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 protein domains)
  6. 2503867Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 2503868Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries)
  8. 2503871Domain d1hz6c_: 1hz6 C: [61431]
    Other proteins in same PDB: d1hz6a2
    b1 domain

Details for d1hz6c_

PDB Entry: 1hz6 (more details), 1.7 Å

PDB Description: crystal structures of the b1 domain of protein l from peptostreptococcus magnus with a tyrosine to tryptophan substitution
PDB Compounds: (C:) protein l

SCOPe Domain Sequences for d1hz6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hz6c_ d.15.7.1 (C:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvadkgytlnik
fag

SCOPe Domain Coordinates for d1hz6c_:

Click to download the PDB-style file with coordinates for d1hz6c_.
(The format of our PDB-style files is described here.)

Timeline for d1hz6c_: