SCOPe 2.01: Domain d1hz6a_: 1hz6 A:

Lineage for d1hz6a_ (1hz6 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)

7. Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries)

8. Domain d1hz6a_: 1hz6 A: [61429]
   b1 domain

Details for d1hz6a_

PDB Entry: 1hz6, 1.7 Å

PDB Description: crystal structures of the b1 domain of protein l from peptostreptococcus magnus with a tyrosine to tryptophan substitution

PDB Compounds: (A:) protein l

SCOPe Domain Sequences for d1hz6a_:

Sequence; same for both SEQRES and ATOM records:

>d1hz6a_ d.15.7.1 (A:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
hhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvadkgyt
lnikfag

Timeline for d1hz6a_:

• d1hz6a_ first appeared in SCOP 1.57
  
• d1hz6a_ appears in SCOP 1.75
  
• d1hz6a_ appears in SCOPe 2.02
  
• d1hz6a_ appears in the current release, SCOPe 2.08, called d1hz6a1