Lineage for d1hz5a1 (1hz5 A:1-64)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934644Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 2934645Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries)
  8. 2934649Domain d1hz5a1: 1hz5 A:1-64 [61427]
    Other proteins in same PDB: d1hz5a2, d1hz5b2
    b1 domain
    complexed with zn

Details for d1hz5a1

PDB Entry: 1hz5 (more details), 1.8 Å

PDB Description: crystal structures of the b1 domain of protein l from peptostreptococcus magnus, with a tyrosine to tryptophan substitution
PDB Compounds: (A:) protein l

SCOPe Domain Sequences for d1hz5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hz5a1 d.15.7.1 (A:1-64) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
meevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvadkgytlni
kfag

SCOPe Domain Coordinates for d1hz5a1:

Click to download the PDB-style file with coordinates for d1hz5a1.
(The format of our PDB-style files is described here.)

Timeline for d1hz5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hz5a2