| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) ![]() |
| Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
| Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species) |
| Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries) |
| Domain d1hz5a1: 1hz5 A:1-64 [61427] Other proteins in same PDB: d1hz5a2, d1hz5b2 b1 domain complexed with zn |
PDB Entry: 1hz5 (more details), 1.8 Å
SCOPe Domain Sequences for d1hz5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hz5a1 d.15.7.1 (A:1-64) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
meevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvadkgytlni
kfag
Timeline for d1hz5a1: