SCOP 1.69: Domain d1hyza_: 1hyz A:

Lineage for d1hyza_ (1hyz A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)

6. Protein Retroviral integrase, catalytic domain [53108] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (17 PDB entries)

8. Domain d1hyza_: 1hyz A: [61426]

Details for d1hyza_

PDB Entry: 1hyz, 2.3 Å

PDB Description: hiv integrase core domain complexed with a derivative of tetraphenyl arsonium.

SCOP Domain Sequences for d1hyza_:

Sequence, based on SEQRES records:

>d1hyza_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkggiggysagerivdiiatdiqt

Sequence, based on observed residues (ATOM records):

>d1hyza_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefgqgviesmnkelkkiigqvrdqaehlktavqmavfih
nkkrkggysagerivdiiatdiqt

Timeline for d1hyza_:

• d1hyza_ first appeared in SCOP 1.57
  
• d1hyza_ appears in SCOP 1.67
  
• d1hyza_ appears in SCOP 1.71
  
• d1hyza_ appears in the current release, SCOPe 2.08