SCOPe 2.03: Domain d1hyva_: 1hyv A:

Lineage for d1hyva_ (1hyv A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (37 PDB entries)

8. Domain d1hyva_: 1hyv A: [61424]
   protein/DNA complex; complexed with cl, so4, tta

Details for d1hyva_

PDB Entry: 1hyv, 1.7 Å

PDB Description: hiv integrase core domain complexed with tetraphenyl arsonium

PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d1hyva_:

Sequence, based on SEQRES records:

>d1hyva_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkggiggysagerivdiiatdiqt

Sequence, based on observed residues (ATOM records):

>d1hyva_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefgqgviesmnkelkkiigqvrdqaehlktavqmavfih
nkkrkggysagerivdiiatdiqt

Timeline for d1hyva_:

• d1hyva_ first appeared in SCOP 1.57
  
• d1hyva_ appears in SCOPe 2.02
  
• d1hyva_ appears in SCOPe 2.04
  
• d1hyva_ appears in the current release, SCOPe 2.08