SCOP 1.63: Domain d1hysd1: 1hys D:1-123

Lineage for d1hysd1 (1hys D:1-123)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab 28 against HIV-1 RT (mouse), kappa L chain [48857] (5 PDB entries)

8. Domain d1hysd1: 1hys D:1-123 [61422]
   Other proteins in same PDB: d1hysa1, d1hysa2, d1hysb_, d1hysc2, d1hysd2
   mutant

Details for d1hysd1

PDB Entry: 1hys, 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna

SCOP Domain Sequences for d1hysd1:

Sequence; same for both SEQRES and ATOM records:

>d1hysd1 b.1.1.1 (D:1-123) Immunoglobulin (variable domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
vss

Timeline for d1hysd1:

• d1hysd1 first appeared in SCOP 1.57
  
• d1hysd1 appears in SCOP 1.61
  
• d1hysd1 appears in SCOP 1.65
  
• d1hysd1 appears in the current release, SCOPe 2.08