Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Fab 28 against HIV-1 RT (mouse), kappa L chain [48857] (5 PDB entries) |
Domain d1hysd1: 1hys D:1-123 [61422] Other proteins in same PDB: d1hysa1, d1hysa2, d1hysb_, d1hysc2, d1hysd2 mutant |
PDB Entry: 1hys (more details), 3 Å
SCOP Domain Sequences for d1hysd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hysd1 b.1.1.1 (D:1-123) Immunoglobulin (variable domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain} qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt vss
Timeline for d1hysd1: