Lineage for d1hysc1 (1hys C:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653521Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
  8. 653730Domain d1hysc1: 1hys C:1-107 [61420]
    Other proteins in same PDB: d1hysa1, d1hysa2, d1hysb_, d1hysc2, d1hysd1, d1hysd2
    part of Fab 28 against HIV-1 RT
    mutant

Details for d1hysc1

PDB Entry: 1hys (more details), 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna
PDB Compounds: (C:) fab-28 monoclonal antibody fragment light chain

SCOP Domain Sequences for d1hysc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hysc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
afsgsgsgtdysltisnlepedfatyycqqyskfpwtfgggtkleik

SCOP Domain Coordinates for d1hysc1:

Click to download the PDB-style file with coordinates for d1hysc1.
(The format of our PDB-style files is described here.)

Timeline for d1hysc1: