Lineage for d1hyrc2 (1hyr C:0-180)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131823Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 131824Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 131825Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)
  6. 132079Protein MHC I homolog [54489] (2 species)
  7. 132080Species Human (Homo sapiens), Mic-a [TaxId:9606] [54490] (2 PDB entries)
  8. 132081Domain d1hyrc2: 1hyr C:0-180 [61416]
    Other proteins in same PDB: d1hyra_, d1hyrb_, d1hyrc1

Details for d1hyrc2

PDB Entry: 1hyr (more details), 2.7 Å

PDB Description: crystal structure of human mica in complex with natural killer cell receptor nkg2d

SCOP Domain Sequences for d1hyrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyrc2 d.19.1.1 (C:0-180) MHC I homolog {Human (Homo sapiens), Mic-a}
mephslrynltvlswdgsvqsgfltevhldgqpflrcdrqkcrakpqgqwaedvlgnktw
dretrdltgngkdlrmtlahikdqkeglhslqeirvceihednstrssqhfyydgelfls
qnletkewtmpqssraqtlamnvrnflkedamktkthyhamhadclqelrrylksgvvlr
r

SCOP Domain Coordinates for d1hyrc2:

Click to download the PDB-style file with coordinates for d1hyrc2.
(The format of our PDB-style files is described here.)

Timeline for d1hyrc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hyrc1