Lineage for d1hyrc1 (1hyr C:181-274)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654519Protein Class I MHC homolog, alpha-3 domain [88610] (4 species)
    gamma, delta T-cell ligand
  7. 654520Species Human (Homo sapiens), Mic-a [TaxId:9606] [48968] (2 PDB entries)
  8. 654521Domain d1hyrc1: 1hyr C:181-274 [61415]
    Other proteins in same PDB: d1hyra_, d1hyrb_, d1hyrc2

Details for d1hyrc1

PDB Entry: 1hyr (more details), 2.7 Å

PDB Description: crystal structure of human mica in complex with natural killer cell receptor nkg2d
PDB Compounds: (C:) MHC class I chain-related protein a

SCOP Domain Sequences for d1hyrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]}
tvppmvnvtrseasegnitvtcrasgfypwnitlswrqdgvslshdtqqwgdvlpdgngt
yqtwvatricqgeeqrftcymehsgnhsthpvps

SCOP Domain Coordinates for d1hyrc1:

Click to download the PDB-style file with coordinates for d1hyrc1.
(The format of our PDB-style files is described here.)

Timeline for d1hyrc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hyrc2