SCOP 1.65: Domain d1hyrc1: 1hyr C:181-274

Lineage for d1hyrc1 (1hyr C:181-274)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC homolog, alpha-3 domain [88610] (3 species)
   gamma, delta T-cell ligand

7. Species Human (Homo sapiens), Mic-a [TaxId:9606] [48968] (2 PDB entries)

8. Domain d1hyrc1: 1hyr C:181-274 [61415]
   Other proteins in same PDB: d1hyra_, d1hyrb_, d1hyrc2

Details for d1hyrc1

PDB Entry: 1hyr, 2.7 Å

PDB Description: crystal structure of human mica in complex with natural killer cell receptor nkg2d

SCOP Domain Sequences for d1hyrc1:

Sequence; same for both SEQRES and ATOM records:

>d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a}
tvppmvnvtrseasegnitvtcrasgfypwnitlswrqdgvslshdtqqwgdvlpdgngt
yqtwvatricqgeeqrftcymehsgnhsthpvps

Timeline for d1hyrc1:

• d1hyrc1 first appeared in SCOP 1.57
  
• d1hyrc1 appears in SCOP 1.63
  
• d1hyrc1 appears in SCOP 1.67
  
• d1hyrc1 appears in the current release, SCOPe 2.08