| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein MHC I homolog [48967] (3 species) gamma, delta T-cell ligand |
| Species Human (Homo sapiens), Mic-a [TaxId:9606] [48968] (2 PDB entries) |
| Domain d1hyrc1: 1hyr C:181-274 [61415] Other proteins in same PDB: d1hyra_, d1hyrb_, d1hyrc2 |
PDB Entry: 1hyr (more details), 2.7 Å
SCOP Domain Sequences for d1hyrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hyrc1 b.1.1.2 (C:181-274) MHC I homolog {Human (Homo sapiens), Mic-a}
tvppmvnvtrseasegnitvtcrasgfypwnitlswrqdgvslshdtqqwgdvlpdgngt
yqtwvatricqgeeqrftcymehsgnhsthpvps
Timeline for d1hyrc1: