Lineage for d1hyra_ (1hyr A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614335Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 614336Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 614337Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
    Pfam 00059
  6. 614544Protein NK cell-activating receptor nkg2d [64453] (2 species)
  7. 614545Species Human (Homo sapiens) [TaxId:9606] [64455] (3 PDB entries)
  8. 614546Domain d1hyra_: 1hyr A: [61413]
    Other proteins in same PDB: d1hyrc1, d1hyrc2

Details for d1hyra_

PDB Entry: 1hyr (more details), 2.7 Å

PDB Description: crystal structure of human mica in complex with natural killer cell receptor nkg2d

SCOP Domain Sequences for d1hyra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyra_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Human (Homo sapiens)}
esycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksy
hwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicm
qrtv

SCOP Domain Coordinates for d1hyra_:

Click to download the PDB-style file with coordinates for d1hyra_.
(The format of our PDB-style files is described here.)

Timeline for d1hyra_: