Lineage for d1hyns_ (1hyn S:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971248Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
    beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing
  4. 2971249Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families) (S)
  5. 2971276Family d.112.1.2: Anion transport protein, cytoplasmic domain [64362] (2 proteins)
    elaborated with additional secondary structures
  6. 2971277Protein Erythrocite membrane Band 3 [64363] (1 species)
  7. 2971278Species Human (Homo sapiens) [TaxId:9606] [64364] (1 PDB entry)
  8. 2971282Domain d1hyns_: 1hyn S: [61411]

Details for d1hyns_

PDB Entry: 1hyn (more details), 2.6 Å

PDB Description: crystal structure of the cytoplasmic domain of human erythrocyte band- 3 protein
PDB Compounds: (S:) band 3 anion transport protein

SCOPe Domain Sequences for d1hyns_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyns_ d.112.1.2 (S:) Erythrocite membrane Band 3 {Human (Homo sapiens) [TaxId: 9606]}
kvyvelqelvmdeknqelrwmeaarwvqleenlgengawgrphlshltfwsllelrrvft
kgtvlldlqetslagvanqlldrfifedqirpqdreellralllkhshagelealggvkp
avltrsgdpsqpllpqhssletqlfceqgdggteghspsgilekippdseatlvlvgrad
fleqpvlgfvrlqeaaeleavelpvpirflfvllgpeaphidytqlgraaatlmservfr
idaymaqsrgellhslegfldcslvlpptdapseqallslvpvqrellrrryq

SCOPe Domain Coordinates for d1hyns_:

Click to download the PDB-style file with coordinates for d1hyns_.
(The format of our PDB-style files is described here.)

Timeline for d1hyns_: