Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily) beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing |
Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families) |
Family d.112.1.2: Anion transport protein, cytoplasmic domain [64362] (2 proteins) elaborated with additional secondary structures |
Protein Erythrocite membrane Band 3 [64363] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64364] (1 PDB entry) |
Domain d1hyns_: 1hyn S: [61411] |
PDB Entry: 1hyn (more details), 2.6 Å
SCOPe Domain Sequences for d1hyns_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hyns_ d.112.1.2 (S:) Erythrocite membrane Band 3 {Human (Homo sapiens) [TaxId: 9606]} kvyvelqelvmdeknqelrwmeaarwvqleenlgengawgrphlshltfwsllelrrvft kgtvlldlqetslagvanqlldrfifedqirpqdreellralllkhshagelealggvkp avltrsgdpsqpllpqhssletqlfceqgdggteghspsgilekippdseatlvlvgrad fleqpvlgfvrlqeaaeleavelpvpirflfvllgpeaphidytqlgraaatlmservfr idaymaqsrgellhslegfldcslvlpptdapseqallslvpvqrellrrryq
Timeline for d1hyns_: