Lineage for d1hygb1 (1hyg B:1-145)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844856Protein MJ0490, lactate/malate dehydrogenase [63941] (1 species)
  7. 2844857Species Methanococcus jannaschii [TaxId:2190] [63942] (2 PDB entries)
  8. 2844860Domain d1hygb1: 1hyg B:1-145 [61404]
    Other proteins in same PDB: d1hyga2, d1hygb2
    complexed with nap

Details for d1hygb1

PDB Entry: 1hyg (more details), 2.8 Å

PDB Description: Crystal structure of MJ0490 gene product, the family of lactate/malate dehydrogenase
PDB Compounds: (B:) l-lactate/malate dehydrogenase

SCOPe Domain Sequences for d1hygb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hygb1 c.2.1.5 (B:1-145) MJ0490, lactate/malate dehydrogenase {Methanococcus jannaschii [TaxId: 2190]}
mkvtiigasgrvgsatalllakepfmkdlvligrehsinkleglrediydalagtrsdan
iyvesdenlriidesdvviitsgvprkegmsrmdlaktnakivgkyakkiaeicdtkifv
itnpvdvmtykalvdskfernqvfg

SCOPe Domain Coordinates for d1hygb1:

Click to download the PDB-style file with coordinates for d1hygb1.
(The format of our PDB-style files is described here.)

Timeline for d1hygb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hygb2