Lineage for d1hyea1 (1hye A:1-145)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1829377Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1829738Protein MJ0490, lactate/malate dehydrogenase [63941] (1 species)
  7. 1829739Species Methanococcus jannaschii [TaxId:2190] [63942] (2 PDB entries)
  8. 1829740Domain d1hyea1: 1hye A:1-145 [61400]
    Other proteins in same PDB: d1hyea2
    complexed with nap

Details for d1hyea1

PDB Entry: 1hye (more details), 1.9 Å

PDB Description: crystal structure of the mj0490 gene product, the family of lactate/malate dehydrogenase, dimeric structure
PDB Compounds: (A:) l-lactate/malate dehydrogenase

SCOPe Domain Sequences for d1hyea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Methanococcus jannaschii [TaxId: 2190]}
mkvtiigasgrvgsatalllakepfmkdlvligrehsinkleglrediydalagtrsdan
iyvesdenlriidesdvviitsgvprkegmsrmdlaktnakivgkyakkiaeicdtkifv
itnpvdvmtykalvdskfernqvfg

SCOPe Domain Coordinates for d1hyea1:

Click to download the PDB-style file with coordinates for d1hyea1.
(The format of our PDB-style files is described here.)

Timeline for d1hyea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hyea2