Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (7 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [63975] (6 PDB entries) |
Domain d1hyba_: 1hyb A: [61399] complexed with nmn, so4; mutant |
PDB Entry: 1hyb (more details), 2 Å
SCOPe Domain Sequences for d1hyba_:
Sequence, based on SEQRES records: (download)
>d1hyba_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Methanobacterium thermoautotrophicum [TaxId: 145262]} mrgllvgrmqpfhrgalqviksileevdeliicigsaqlshsirdpftagervmmltkal sengipasryyiipvqdiecnalwvghikmltppfdrvysgnplvqrlfsedgyevtapp lfyrdrysgtevrrrmlddgdwrsllpesvvevideingverikhla
>d1hyba_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Methanobacterium thermoautotrophicum [TaxId: 145262]} mrgllvgrmqpfhrgalqviksileevdeliicigsaqlshsirdpftagervmmltkal sengipasryyiipvqdiecnalwvghikmltppfdrvysgnplvqrlfsedgyevtapp ysgtevrrrmlddgdwrsllpesvvevideingverikhla
Timeline for d1hyba_: