Lineage for d1hyba_ (1hyb A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 984755Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 984756Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 984996Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 985025Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (7 species)
  7. 985080Species Methanobacterium thermoautotrophicum [TaxId:145262] [63975] (6 PDB entries)
  8. 985083Domain d1hyba_: 1hyb A: [61399]
    complexed with nmn, so4; mutant

Details for d1hyba_

PDB Entry: 1hyb (more details), 2 Å

PDB Description: crystal structure of an active site mutant of methanobacterium thermoautotrophicum nicotinamide mononucleotide adenylyltransferase
PDB Compounds: (A:) nicotinamide mononucleotide adenylyltransferase

SCOPe Domain Sequences for d1hyba_:

Sequence, based on SEQRES records: (download)

>d1hyba_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mrgllvgrmqpfhrgalqviksileevdeliicigsaqlshsirdpftagervmmltkal
sengipasryyiipvqdiecnalwvghikmltppfdrvysgnplvqrlfsedgyevtapp
lfyrdrysgtevrrrmlddgdwrsllpesvvevideingverikhla

Sequence, based on observed residues (ATOM records): (download)

>d1hyba_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mrgllvgrmqpfhrgalqviksileevdeliicigsaqlshsirdpftagervmmltkal
sengipasryyiipvqdiecnalwvghikmltppfdrvysgnplvqrlfsedgyevtapp
ysgtevrrrmlddgdwrsllpesvvevideingverikhla

SCOPe Domain Coordinates for d1hyba_:

Click to download the PDB-style file with coordinates for d1hyba_.
(The format of our PDB-style files is described here.)

Timeline for d1hyba_: