Lineage for d1hy9a_ (1hy9 A:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 268805Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 269670Superfamily g.3.17: Satiety factor CART (cocaine and amphetamine regulated transcript) [64546] (1 family) (S)
  5. 269671Family g.3.17.1: Satiety factor CART (cocaine and amphetamine regulated transcript) [64547] (1 protein)
  6. 269672Protein Satiety factor CART (cocaine and amphetamine regulated transcript) [64548] (1 species)
  7. 269673Species Human (Homo sapiens) [TaxId:9606] [64549] (1 PDB entry)
  8. 269674Domain d1hy9a_: 1hy9 A: [61398]
    C-terminal domain

Details for d1hy9a_

PDB Entry: 1hy9 (more details)

PDB Description: cocaine and amphetamine regulated transcript

SCOP Domain Sequences for d1hy9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hy9a_ g.3.17.1 (A:) Satiety factor CART (cocaine and amphetamine regulated transcript) {Human (Homo sapiens)}
ygqvpmcdageqcavrkgarigklcdcprgtscnsfllkcl

SCOP Domain Coordinates for d1hy9a_:

Click to download the PDB-style file with coordinates for d1hy9a_.
(The format of our PDB-style files is described here.)

Timeline for d1hy9a_: