![]() | Class g: Small proteins [56992] (61 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) disulphide-bound fold; contains beta-hairpin with two adjacent disulphides |
![]() | Superfamily g.3.17: Satiety factor CART (cocaine and amphetamine regulated transcript) [64546] (1 family) ![]() |
![]() | Family g.3.17.1: Satiety factor CART (cocaine and amphetamine regulated transcript) [64547] (1 protein) |
![]() | Protein Satiety factor CART (cocaine and amphetamine regulated transcript) [64548] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64549] (1 PDB entry) |
![]() | Domain d1hy9a_: 1hy9 A: [61398] C-terminal domain |
PDB Entry: 1hy9 (more details)
SCOP Domain Sequences for d1hy9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hy9a_ g.3.17.1 (A:) Satiety factor CART (cocaine and amphetamine regulated transcript) {Human (Homo sapiens)} ygqvpmcdageqcavrkgarigklcdcprgtscnsfllkcl
Timeline for d1hy9a_: