Lineage for d1hy9a_ (1hy9 A:)
- Root: SCOP 1.61
Class g: Small proteins [56992] (59 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) 
Superfamily g.3.17: Satiety factor CART (cocaine and amphetamine regulated transcript) [64546] (1 family) 
Family g.3.17.1: Satiety factor CART (cocaine and amphetamine regulated transcript) [64547] (1 protein) Protein Satiety factor CART (cocaine and amphetamine regulated transcript) [64548] (1 species) Species Human (Homo sapiens) [TaxId:9606] [64549] (1 PDB entry) 
Domain d1hy9a_: 1hy9 A: [61398]
Details for d1hy9a_
PDB Entry: 1hy9 (more details)
PDB Description: cocaine and amphetamine regulated transcript
SCOP Domain Sequences for d1hy9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hy9a_ g.3.17.1 (A:) Satiety factor CART (cocaine and amphetamine regulated transcript) {Human (Homo sapiens)}
ygqvpmcdageqcavrkgarigklcdcprgtscnsfllkcl
SCOP Domain Coordinates for d1hy9a_:
Click to download the PDB-style file with coordinates for d1hy9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hy9a_:
- d1hy9a_ first appeared in SCOP 1.57
- d1hy9a_ appears in SCOP 1.59
- d1hy9a_ appears in SCOP 1.63
- d1hy9a_ appears in the current release, SCOPe 2.08
View in 3D