Lineage for d1hy1c_ (1hy1 C:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 285775Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 285776Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 285777Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 285791Protein Argininosuccinate lyase/delta-crystallin [48564] (3 species)
  7. 285792Species Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId:8839] [48566] (5 PDB entries)
  8. 285809Domain d1hy1c_: 1hy1 C: [61396]

Details for d1hy1c_

PDB Entry: 1hy1 (more details), 2.3 Å

PDB Description: crystal structure of wild type duck delta 2 crystallin (eye lens protein)

SCOP Domain Sequences for d1hy1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hy1c_ a.127.1.1 (C:) Argininosuccinate lyase/delta-crystallin {Domestic duck (Anas platyrhynchos), delta-crystallin}
stdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseews
kgvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisth
llqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrin
vlplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlsk
maedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlk
glpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlal
ylvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsve
qytalagtakssvttqieqlrelmkkqke

SCOP Domain Coordinates for d1hy1c_:

Click to download the PDB-style file with coordinates for d1hy1c_.
(The format of our PDB-style files is described here.)

Timeline for d1hy1c_: