Lineage for d1hy0b_ (1hy0 B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156518Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 156519Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 156520Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 156534Protein Argininosuccinate lyase/delta-crystallin [48564] (3 species)
  7. 156535Species Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId:8839] [48566] (5 PDB entries)
  8. 156537Domain d1hy0b_: 1hy0 B: [61393]

Details for d1hy0b_

PDB Entry: 1hy0 (more details), 2.2 Å

PDB Description: crystal structure of wild type duck delta 1 crystallin (eye lens protein)

SCOP Domain Sequences for d1hy0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hy0b_ a.127.1.1 (B:) Argininosuccinate lyase/delta-crystallin {Domestic duck (Anas platyrhynchos), delta-crystallin}
dpimqmlstsisteqrlsevdiqasiayakalekagiltktelekilsglekiseelskg
vivvtqsdediqtanerrlkeligdiagklhtgrsrneqvvtdlklfmknslsiisthll
qliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrinvl
plgsgalagnpldidremlrselefasislnsmdaiserdfvveflsvatlllihlskma
edliiystsefgfltlsdafstgsslmpqkknpdslelirsksgrvfgrlasilmvlkgl
pstynkdlqedkeavidvvdtltavlqvatgvistlqiskenmekaltpemlatdlalyl
vrkgmpfrqahtasgkavhlaetkgiainnltledlksisplfssdvsqvfnfvnsveqy
talggtakssvttqieqlrelmkkqkeq

SCOP Domain Coordinates for d1hy0b_:

Click to download the PDB-style file with coordinates for d1hy0b_.
(The format of our PDB-style files is described here.)

Timeline for d1hy0b_: