Lineage for d1hxyd2 (1hxy D:102-213)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253998Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 254362Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 254363Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 254408Protein Staphylococcal enterotoxin H, SEH [54346] (1 species)
  7. 254409Species Staphylococcus aureus [TaxId:1280] [54347] (4 PDB entries)
  8. 254414Domain d1hxyd2: 1hxy D:102-213 [61391]
    Other proteins in same PDB: d1hxya1, d1hxya2, d1hxyb1, d1hxyb2, d1hxyd1
    complexed with zn

Details for d1hxyd2

PDB Entry: 1hxy (more details), 2.6 Å

PDB Description: crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii
PDB Compounds: (D:)

SCOP Domain Sequences for d1hxyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxyd2 d.15.6.1 (D:102-213) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus}
eklaqerviganvwvdgiqketelirtnkknvtlqeldikirkilsdkykiyykdseisk
gliefdmktprdysfdiydlkgendyeidkiyednktlksddishidvnlyt

SCOP Domain Coordinates for d1hxyd2:

Click to download the PDB-style file with coordinates for d1hxyd2.
(The format of our PDB-style files is described here.)

Timeline for d1hxyd2: