Lineage for d1hxyd2 (1hxy D:102-213)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934366Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2934464Protein Staphylococcal enterotoxin H, SEH [54346] (1 species)
  7. 2934465Species Staphylococcus aureus [TaxId:1280] [54347] (5 PDB entries)
  8. 2934471Domain d1hxyd2: 1hxy D:102-213 [61391]
    Other proteins in same PDB: d1hxya1, d1hxya2, d1hxyb1, d1hxyb2, d1hxyd1
    complexed with zn

Details for d1hxyd2

PDB Entry: 1hxy (more details), 2.6 Å

PDB Description: crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii
PDB Compounds: (D:) enterotoxin h

SCOPe Domain Sequences for d1hxyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxyd2 d.15.6.1 (D:102-213) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]}
eklaqerviganvwvdgiqketelirtnkknvtlqeldikirkilsdkykiyykdseisk
gliefdmktprdysfdiydlkgendyeidkiyednktlksddishidvnlyt

SCOPe Domain Coordinates for d1hxyd2:

Click to download the PDB-style file with coordinates for d1hxyd2.
(The format of our PDB-style files is described here.)

Timeline for d1hxyd2: