| Class b: All beta proteins [48724] (177 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
| Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) |
| Protein Staphylococcal enterotoxin H, SEH [50230] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [50231] (5 PDB entries) |
| Domain d1hxyd1: 1hxy D:2-101 [61390] Other proteins in same PDB: d1hxya1, d1hxya2, d1hxyb1, d1hxyb2, d1hxyd2 complexed with zn |
PDB Entry: 1hxy (more details), 2.6 Å
SCOPe Domain Sequences for d1hxyd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxyd1 b.40.2.2 (D:2-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]}
dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
laqkfknknvdiygasfyykcekiseniseclyggttlns
Timeline for d1hxyd1:
View in 3DDomains from other chains: (mouse over for more information) d1hxya1, d1hxya2, d1hxyb1, d1hxyb2 |