Lineage for d1hxyd1 (1hxy D:2-101)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59002Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 59304Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 59343Protein Staphylococcal enterotoxin H, SEH [50230] (1 species)
  7. 59344Species Staphylococcus aureus [TaxId:1280] [50231] (4 PDB entries)
  8. 59349Domain d1hxyd1: 1hxy D:2-101 [61390]
    Other proteins in same PDB: d1hxya1, d1hxya2, d1hxyb1, d1hxyb2, d1hxyd2

Details for d1hxyd1

PDB Entry: 1hxy (more details), 2.6 Å

PDB Description: crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii

SCOP Domain Sequences for d1hxyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxyd1 b.40.2.2 (D:2-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus}
dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
laqkfknknvdiygasfyykcekiseniseclyggttlns

SCOP Domain Coordinates for d1hxyd1:

Click to download the PDB-style file with coordinates for d1hxyd1.
(The format of our PDB-style files is described here.)

Timeline for d1hxyd1: