Lineage for d1hxyb1 (1hxy B:93-190)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53149Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (10 species)
  7. 53156Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (6 PDB entries)
  8. 53166Domain d1hxyb1: 1hxy B:93-190 [61388]
    Other proteins in same PDB: d1hxya2, d1hxyb2, d1hxyd1, d1hxyd2

Details for d1hxyb1

PDB Entry: 1hxy (more details), 2.6 Å

PDB Description: crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii

SCOP Domain Sequences for d1hxyb1:

Sequence, based on SEQRES records: (download)

>d1hxyb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d1hxyb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rrvepkvtvyphnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqtlvm
letvprsgevytcqvehpsvtspltvewra

SCOP Domain Coordinates for d1hxyb1:

Click to download the PDB-style file with coordinates for d1hxyb1.
(The format of our PDB-style files is described here.)

Timeline for d1hxyb1: