Lineage for d1hxya2 (1hxy A:3-81)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545290Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2545300Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
    Uniprot P01903 28-207
  8. 2545324Domain d1hxya2: 1hxy A:3-81 [61387]
    Other proteins in same PDB: d1hxya1, d1hxyb1, d1hxyb2, d1hxyd1, d1hxyd2
    complexed with zn

Details for d1hxya2

PDB Entry: 1hxy (more details), 2.6 Å

PDB Description: crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1hxya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxya2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOPe Domain Coordinates for d1hxya2:

Click to download the PDB-style file with coordinates for d1hxya2.
(The format of our PDB-style files is described here.)

Timeline for d1hxya2: