Lineage for d1hxmh1 (1hxm H:1-123)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757747Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1757828Species Human (Homo sapiens), delta-chain [TaxId:9606] [48938] (3 PDB entries)
  8. 1757834Domain d1hxmh1: 1hxm H:1-123 [61381]
    Other proteins in same PDB: d1hxma2, d1hxmb2, d1hxmc2, d1hxmd2, d1hxme2, d1hxmf2, d1hxmg2, d1hxmh2
    complexed with so4

Details for d1hxmh1

PDB Entry: 1hxm (more details), 3.12 Å

PDB Description: crystal structure of a human vgamma9/vdelta2 t cell receptor
PDB Compounds: (H:) gamma-delta T-cell receptor

SCOPe Domain Sequences for d1hxmh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxmh1 b.1.1.1 (H:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]}
aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
itd

SCOPe Domain Coordinates for d1hxmh1:

Click to download the PDB-style file with coordinates for d1hxmh1.
(The format of our PDB-style files is described here.)

Timeline for d1hxmh1: