Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63651] (3 PDB entries) |
Domain d1hxmg1: 1hxm G:1-120 [61379] Other proteins in same PDB: d1hxma2, d1hxmb2, d1hxmc2, d1hxmd2, d1hxme2, d1hxmf2, d1hxmg2, d1hxmh2 complexed with so4 |
PDB Entry: 1hxm (more details), 3.12 Å
SCOPe Domain Sequences for d1hxmg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxmg1 b.1.1.1 (G:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr
Timeline for d1hxmg1: